PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG044611t1
Common NameTCM_044611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MYB
Protein Properties Length: 556aa    MW: 60387.2 Da    PI: 4.7072
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG044611t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-173986148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Thecc1EG044611t1 39 KGPWTSAEDAILIEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                      79******************************************9986 PP

2Myb_DNA-binding53.94.1e-1792135146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
  Thecc1EG044611t1  92 KGAFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                       799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4093486IPR017930Myb domain
SuperFamilySSF466891.87E-3037133IPR009057Homeodomain-like
SMARTSM007171.2E-153888IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-244093IPR009057Homeodomain-like
CDDcd001674.13E-124186No hitNo description
PfamPF139214.3E-1642102No hitNo description
PROSITE profilePS5129426.87287141IPR017930Myb domain
SMARTSM007172.3E-1791139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2694140IPR009057Homeodomain-like
CDDcd001671.11E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MSHTKNERED GMLSEDQAES PLADDGNCGG AGGGVVMKKG PWTSAEDAIL IEYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTQEEE QLIIELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVCLQALQES HSTSAVNGGD KGPQDIMQNN  180
SYQIPDVIFD SLKANQSVLP YVPELPDIST SSMLMKGLGS SQYCSFMPPT IHRQKRLRES  240
TAFFPGYTGA VKNECPLFDQ FQDDMSDKAA QSFGVSFQIE PDPTAKNSES FGVFPGSHAL  300
TNGNFSASES SLEAVKLELP SLQYPETELG NWGTISCPPP LLESVDAFIQ SPPPTSGVES  360
DSLSPHNSGL LDALLHEAKT LSSAKNHASD KSSNSSTPGD IAESSNFNIC ETEWENCGQP  420
LSPMGHSATS LFSECISASG SSLDEQPPAE TFTESHVKSE TADHVFTPEI QKEAPIRLDS  480
TRPDTLLASN WLEQGCVYDK DQTIMSDAIA TLLGDDLSSE YKNMAAGTSI SSQAWGLGSC  540
AWNNMPAVCQ MSELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32391407107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007010686.10.0Myb domain protein 65, putative isoform 1
RefseqXP_007010687.10.0Myb domain protein 65, putative isoform 1
TrEMBLA0A061FS540.0A0A061FS54_THECC; Myb domain protein 65, putative isoform 1
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-145myb domain protein 33
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]